How to Import Proteins from the Protein Data Bank

Learn how to use OpenAD to easily import protein data from the RCSB Protein Data Bank using a protein's PDB ID or FASTA string.

Install OpenAD

Find more detailed installation instructions here.

Bash

pip install openad

Note

To run this tutorial from a Jupyter Notebook, make sure to enable OpenAD magic commands and prepend every command with %openad.

Importing a Protein

First we visualize a protein, either by its PDB id, or by searching for a FASTA string:

Bash

show protein '9J4J'

Bash

show protein 'MSLNRHFTVSVFIVCKDKVLLHLHKKAKKMLPLGGHIEVNELPEEACIREAKEEAGLNVTLYNPIDINLKKSCDLSGEKLLINPIHTILGDVSPNHSHIDFVYYATTTSFETSPEIGESKILKWYSKEDLKNAHNIQENILVMATEALDLLEGHHHHHH'

This will open the protein in the macromolecule viewer, from where you can save it to your workspace.

Continue Learning

Want to learn more about how to work with proteins in OpenAD?
Check out the other protein tutorials.